PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00189.1.p
Common NameEUGRSUZ_J00189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 211aa    MW: 23025.8 Da    PI: 8.3575
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00189.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92e-122341447
                      HHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding 14 davkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      ++v+q+G+++W++I+  ++ gR++k+c++rw + 
  Eucgr.J00189.1.p  2 KLVEQHGPRNWSLISTGIP-GRSGKSCRLRWCNQ 34
                      79*****************.***********985 PP

2Myb_DNA-binding53.55.4e-174385347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      ++T+ Ed  +v+a+k +G++ W+tIar ++ gRt++ +k++w++ 
  Eucgr.J00189.1.p 43 SFTPLEDATIVEAHKVHGNK-WATIARLLP-GRTDNAIKNHWNST 85
                      69******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-17141IPR009057Homeodomain-like
PROSITE profilePS5129415.903135IPR017930Myb domain
CDDcd001671.26E-9233No hitNo description
PfamPF002493.1E-11234IPR001005SANT/Myb domain
SMARTSM007170.17237IPR001005SANT/Myb domain
SuperFamilySSF466892.41E-241590IPR009057Homeodomain-like
PROSITE profilePS5129424.0193690IPR017930Myb domain
SMARTSM007178.6E-144088IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-224289IPR009057Homeodomain-like
PfamPF002494.8E-144385IPR001005SANT/Myb domain
CDDcd001671.05E-114386No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MKLVEQHGPR NWSLISTGIP GRSGKSCRLR WCNQLSPTVQ HRSFTPLEDA TIVEAHKVHG  60
NKWATIARLL PGRTDNAIKN HWNSTLRRKR PGEQSSMSSE SNSEKHPGRD NTAAESETDL  120
EIKRQCLRVL PDENSRDGEV RPKGPRTSLT LSPPGGGVVA ALEDDKAAPN QADGDQDPAS  180
TRSGDAKVAA ATAAMDDSCL VMIMKRMIAE E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-3418916104MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-3318970158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-3318970158MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-3418916104C-Myb DNA-Binding Domain
1msf_C4e-3418916104C-Myb DNA-Binding Domain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00189.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7700274e-38KC770027.1 Pyrus pyrifolia microsatellite TXY079 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010031187.11e-155PREDICTED: myb-related protein A-like
TrEMBLA0A059A9S41e-155A0A059A9S4_EUCGR; Uncharacterized protein (Fragment)
STRINGPOPTR_0008s07100.11e-71(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-46myb domain protein 73